IGF1-LR3 1mg
$48.50
IGF1 LR3 (Long R3 Insulin-like Growth Factor) is a polypeptide hormone with properties similar to insulin. However, LR3 is a modified form of IGF1 to increase half-life and to prevent deactivation due to protein binding. IGF1 LR3 contains 83 amino acids with substitution of Arginine instead of Glutamic acid at position 3. Altered polypeptide sequence prevents protein binding and increases half-life. The biomolecule exert fat metabolizing properties in addition with transportation of glucose and amino acids into the cells to aid protein biosynthesis. Research evidences suggest that IGF1 LR3 promote muscle cell hyperplasia, increase neuro-functions and nitrogen retention in cells. The molecular weight and molecular mass of IGF1 LR3 is 9.200 and C990H1528N262O300S7, respectively.
IGF-1 LR3 allows many growth factors in the category of IGF’s to increase protein formation through nitrogen retention. The long version is more effective than the original IGF-1; it has an enhanced potency because of increased binding sites. The hormone is effective in accentuating hyperplasia, it is widely known for its activity in the splitting and formation of new muscle cells. IGF-1 LR3 is a synthetic version of the natural insulin like growth factor but with modification at the position number 3, and an extension at the amino acid number 13 at the B-termini. It is more potent than insulin like growth factor 1. Moreover, research reveals that it has a longer half-life than IGF-1, the polypeptide plays a vital role in muscle renewal and it encourages the production and differential of stem cells. IGF-1LR3 is known to increase satellite activity of the cells, muscle protein content, muscle DNA, and muscle cross sectional area and muscle weight. The essence of the polypeptide lies in the fact that it induces muscles growth by enhancing hyperplasia.
IGF1-LR3 Chemical Profile
CAS: 946870-92-4
Formula: C990H1528N262O300S7
Molecular weight: 9200
Peptide purity: > 99.0%
Chain: MFPAMPLSSLFVNGPRTLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIV DECCFRSCDLRRLEMYCAPLKPAKSA
Out of stock
Additional information
| Weight | 42.50 kg |
|---|





